Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) zinc-binding motif |
Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins) |
Protein automated matches [190324] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188953] (11 PDB entries) |
Domain d3n1gb_: 3n1g B: [181784] Other proteins in same PDB: d3n1gc_, d3n1gd_ automated match to d1vhha_ complexed with ca, mg, zn |
PDB Entry: 3n1g (more details), 1.9 Å
SCOPe Domain Sequences for d3n1gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n1gb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qlvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk ygllarlaveagfdwvyyesrnhvhvsvkad
Timeline for d3n1gb_: