Lineage for d3n1fb_ (3n1f B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208182Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1208183Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 1208188Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
  6. 1208201Protein automated matches [190324] (1 species)
    not a true protein
  7. 1208202Species Human (Homo sapiens) [TaxId:9606] [188953] (11 PDB entries)
  8. 1208204Domain d3n1fb_: 3n1f B: [181780]
    Other proteins in same PDB: d3n1fc_, d3n1fd_
    automated match to d1vhha_
    complexed with ca, zn

Details for d3n1fb_

PDB Entry: 3n1f (more details), 1.6 Å

PDB Description: Crystal Structure of IhhN bound to CDOFn3
PDB Compounds: (B:) Indian hedgehog protein

SCOPe Domain Sequences for d3n1fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1fb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdeentgadrlm
tqrckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrnky
gllarlaveagfdwvyyeskahvhcsvkse

SCOPe Domain Coordinates for d3n1fb_:

Click to download the PDB-style file with coordinates for d3n1fb_.
(The format of our PDB-style files is described here.)

Timeline for d3n1fb_: