SCOPe 2.08: Domain d3n10a_: 3n10 A:

Lineage for d3n10a_ (3n10 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.0: automated matches [191434] (1 protein)
   not a true family

6. Protein automated matches [190625] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [189376] (3 PDB entries)

8. Domain d3n10a_: 3n10 A: [181768]
   automated match to d2acaa1
   complexed with cmp, mn, so4

Details for d3n10a_

PDB Entry: 3n10, 1.6 Å

PDB Description: product complex of adenylate cyclase class iv

PDB Compounds: (A:) Adenylate cyclase 2

SCOPe Domain Sequences for d3n10a_:

Sequence; same for both SEQRES and ATOM records:

>d3n10a_ d.63.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
hfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlr
emnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhi
tvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf

Timeline for d3n10a_:

• d3n10a_ first appeared in SCOPe 2.01
  
• d3n10a_ appears in SCOPe 2.07