SCOPe 2.08: Domain d3n0zb_: 3n0z B:

Lineage for d3n0zb_ (3n0z B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.0: automated matches [191434] (1 protein)
   not a true family

6. Protein automated matches [190625] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [189376] (3 PDB entries)

8. Domain d3n0zb_: 3n0z B: [181767]
   automated match to d2acaa1
   complexed with 3at, mn

Details for d3n0zb_

PDB Entry: 3n0z, 1.7 Å

PDB Description: adenylate cyclase class iv with active site ligand 3at

PDB Compounds: (B:) Adenylate cyclase 2

SCOPe Domain Sequences for d3n0zb_:

Sequence; same for both SEQRES and ATOM records:

>d3n0zb_ d.63.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
hfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlr
emnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhi
tvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf

Timeline for d3n0zb_:

• d3n0zb_ first appeared in SCOPe 2.01
  
• d3n0zb_ appears in SCOPe 2.07