SCOPe 2.02: Domain d3mupd_: 3mup D:

Lineage for d3mupd_ (3mup D:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (12 PDB entries)

8. Domain d3mupd_: 3mup D: [181573]
   automated match to d1qbha_
   complexed with smk, zn

Details for d3mupd_

PDB Entry: 3mup, 2.6 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac037

PDB Compounds: (D:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3mupd_:

Sequence; same for both SEQRES and ATOM records:

>d3mupd_ g.52.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgryphlleqlls

Timeline for d3mupd_:

• d3mupd_ first appeared in SCOPe 2.01
  
• d3mupd_ appears in SCOPe 2.03
  
• d3mupd_ appears in the current release, SCOPe 2.08