Lineage for d3mjob_ (3mjo B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911853Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 911866Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)
  8. 911868Domain d3mjob_: 3mjo B: [181305]
    automated match to d1kgna_
    complexed with mn3

Details for d3mjob_

PDB Entry: 3mjo (more details), 1.36 Å

PDB Description: small subunit (r2f) of native ribonucleotide reductase from corynebacterium ammoniagenes
PDB Compounds: (B:) Ribonucleotide reductase subunit R2F

SCOPe Domain Sequences for d3mjob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjob_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOPe Domain Coordinates for d3mjob_:

Click to download the PDB-style file with coordinates for d3mjob_.
(The format of our PDB-style files is described here.)

Timeline for d3mjob_: