![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) ![]() |
![]() | Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein) |
![]() | Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species) inserted in the phosphohistidine domain |
![]() | Species Escherichia coli [TaxId:562] [47834] (11 PDB entries) |
![]() | Domain d3ezea1: 3eze A:22-144 [18121] Other proteins in same PDB: d3ezea2, d3ezeb_ complexed with po3 |
PDB Entry: 3eze (more details)
SCOPe Domain Sequences for d3ezea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezea1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]} deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni lgl
Timeline for d3ezea1: