Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries) |
Domain d3mgra_: 3mgr A: [181201] Other proteins in same PDB: d3mgrb_, d3mgrc_, d3mgrd_, d3mgrf_, d3mgrg_, d3mgrh_ automated match to d1kx5a_ protein/DNA complex; complexed with cl, mn, rb |
PDB Entry: 3mgr (more details), 2.3 Å
SCOPe Domain Sequences for d3mgra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgra_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d3mgra_: