Lineage for d3mgra_ (3mgr A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725867Protein Histone H3 [47122] (6 species)
  7. 1725868Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1725905Domain d3mgra_: 3mgr A: [181201]
    Other proteins in same PDB: d3mgrb_, d3mgrc_, d3mgrd_, d3mgrf_, d3mgrg_, d3mgrh_
    automated match to d1kx5a_
    protein/DNA complex; complexed with cl, mn, rb

Details for d3mgra_

PDB Entry: 3mgr (more details), 2.3 Å

PDB Description: binding of rubidium ions to the nucleosome core particle
PDB Compounds: (A:) Histone H3.2

SCOPe Domain Sequences for d3mgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgra_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d3mgra_:

Click to download the PDB-style file with coordinates for d3mgra_.
(The format of our PDB-style files is described here.)

Timeline for d3mgra_: