Lineage for d3mg8u_ (3mg8 U:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439179Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (34 PDB entries)
  8. 1439246Domain d3mg8u_: 3mg8 U: [181183]
    Other proteins in same PDB: d3mg81_, d3mg82_, d3mg8a_, d3mg8b_, d3mg8c_, d3mg8d_, d3mg8e_, d3mg8f_, d3mg8h_, d3mg8i_, d3mg8j_, d3mg8k_, d3mg8m_, d3mg8n_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8r_, d3mg8s_, d3mg8t_, d3mg8v_, d3mg8w_, d3mg8x_, d3mg8y_
    automated match to d1g65g_
    complexed with l3t, mes, mg

Details for d3mg8u_

PDB Entry: 3mg8 (more details), 2.59 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 16
PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3mg8u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg8u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3mg8u_:

Click to download the PDB-style file with coordinates for d3mg8u_.
(The format of our PDB-style files is described here.)

Timeline for d3mg8u_: