Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries) |
Domain d3mg8u_: 3mg8 U: [181183] Other proteins in same PDB: d3mg82_, d3mg8a_, d3mg8b_, d3mg8c_, d3mg8e_, d3mg8f_, d3mg8h_, d3mg8i_, d3mg8j_, d3mg8k_, d3mg8n_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8s_, d3mg8t_, d3mg8v_, d3mg8w_, d3mg8x_, d3mg8y_ automated match to d1g65g_ complexed with l3t, mes, mg |
PDB Entry: 3mg8 (more details), 2.59 Å
SCOPe Domain Sequences for d3mg8u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg8u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3mg8u_: