Lineage for d1flod1 (1flo D:2-129)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1090960Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 1090961Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 1091012Protein Flp recombinase [47829] (1 species)
  7. 1091013Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (3 PDB entries)
  8. 1091021Domain d1flod1: 1flo D:2-129 [18109]
    Other proteins in same PDB: d1floa2, d1flob2, d1floc2, d1flod2
    protein/DNA complex; complexed with phs

Details for d1flod1

PDB Entry: 1flo (more details), 2.65 Å

PDB Description: FLP Recombinase-Holliday Junction Complex I
PDB Compounds: (D:) flp recombinase

SCOPe Domain Sequences for d1flod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flod1 a.60.9.1 (D:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pqfdilcktppkvlvrqfverferpsgekialcaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyygqkhqsditdivs
slqlqfes

SCOPe Domain Coordinates for d1flod1:

Click to download the PDB-style file with coordinates for d1flod1.
(The format of our PDB-style files is described here.)

Timeline for d1flod1: