SCOPe 2.01: Domain d3m39a_: 3m39 A:

Lineage for d3m39a_ (3m39 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (225 PDB entries)
   Uniprot P02185

8. Domain d3m39a_: 3m39 A: [180783]
   automated match to d104ma_
   complexed with fe2, hem

Details for d3m39a_

PDB Entry: 3m39, 1.65 Å

PDB Description: the roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: fe(ii)-i107e febmb (fe(ii) binding to feb site)

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3m39a_:

Sequence; same for both SEQRES and ATOM records:

>d3m39a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefeseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d3m39a_:

• d3m39a_ is new in SCOPe 2.01-stable
  
• d3m39a_ appears in SCOPe 2.02
  
• d3m39a_ appears in the current release, SCOPe 2.08