Lineage for d3m1nb_ (3m1n B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912411Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1912412Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 1912417Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 1912431Protein automated matches [190324] (2 species)
    not a true protein
  7. 1912432Species Human (Homo sapiens) [TaxId:9606] [188953] (16 PDB entries)
  8. 1912446Domain d3m1nb_: 3m1n B: [180717]
    automated match to d1vhha_
    complexed with so4, zn

Details for d3m1nb_

PDB Entry: 3m1n (more details), 1.85 Å

PDB Description: crystal structure of human sonic hedgehog n-terminal domain
PDB Compounds: (B:) Sonic hedgehog protein

SCOPe Domain Sequences for d3m1nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m1nb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iigpgrgfgkrrhpkkltplaykqfipnvaektlgasgryegkisrnserfkeltpnynp
diifkdeentgadrlmtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhye
gravdittsdrdrskygmlarlaveagfdwvyyeskahihcsvkaens

SCOPe Domain Coordinates for d3m1nb_:

Click to download the PDB-style file with coordinates for d3m1nb_.
(The format of our PDB-style files is described here.)

Timeline for d3m1nb_: