Lineage for d3lr7a_ (3lr7 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903195Protein Myoglobin [46469] (9 species)
  7. 903200Species Horse (Equus caballus) [TaxId:9796] [46474] (53 PDB entries)
  8. 903223Domain d3lr7a_: 3lr7 A: [180523]
    automated match to d1azia_
    complexed with hem, no2, so4

Details for d3lr7a_

PDB Entry: 3lr7 (more details), 1.6 Å

PDB Description: Ferric horse heart myoglobin, nitrite adduct
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3lr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lr7a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgf

SCOPe Domain Coordinates for d3lr7a_:

Click to download the PDB-style file with coordinates for d3lr7a_.
(The format of our PDB-style files is described here.)

Timeline for d3lr7a_: