Lineage for d3lqya_ (3lqy A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986330Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 986331Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 986365Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 986366Protein automated matches [190499] (6 species)
    not a true protein
  7. 986380Species Oleispira antarctica [TaxId:188908] [189277] (1 PDB entry)
  8. 986381Domain d3lqya_: 3lqy A: [180522]
    automated match to d1j2ra_
    complexed with gol

Details for d3lqya_

PDB Entry: 3lqy (more details), 1.75 Å

PDB Description: crystal structure of putative isochorismatase hydrolase from oleispira antarctica
PDB Compounds: (A:) putative isochorismatase hydrolase

SCOPe Domain Sequences for d3lqya_:

Sequence, based on SEQRES records: (download)

>d3lqya_ c.33.1.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
gmttenttalllidfqndyfstyngaknplvgteaaaeqgakllakfrqqglpvvhvrhe
fptdeapfflpgsdgakihpsvaaqegeavvlkhqinsfrdtdlkkvlddagikklvivg
amthmcidavtraaedlgyecavahdacatldlefngitvpaaqvhaafmsalsfayanv
asadeliag

Sequence, based on observed residues (ATOM records): (download)

>d3lqya_ c.33.1.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
gmttenttalllidfqndyfstyngaknplvgteaaaeqgakllakfrqqglpvvhvrhe
ftdeapfflpgsdgakihpsvaaqegeavvlkhqinsfrdtdlkkvlddaikklvivgam
thmcidavtraaedlgyecavahdacatldlefngitvpaaqvhaafmsalsfayanvas
adeliag

SCOPe Domain Coordinates for d3lqya_:

Click to download the PDB-style file with coordinates for d3lqya_.
(The format of our PDB-style files is described here.)

Timeline for d3lqya_: