SCOPe 2.05: Domain d3lnxa_: 3lnx A:

Lineage for d3lnxa_ (3lnx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Phosphatase hPTP1e [50168] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50169] (7 PDB entries)

8. Domain d3lnxa_: 3lnx A: [180429]
   automated match to d1d5ga_
   complexed with iod, scn

Details for d3lnxa_

PDB Entry: 3lnx, 1.64 Å

PDB Description: second pdz domain from human ptp1e

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d3lnxa_:

Sequence; same for both SEQRES and ATOM records:

>d3lnxa_ b.36.1.1 (A:) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
vngvslegathkqavetlrntgqvvhlllekgqs

Timeline for d3lnxa_:

• d3lnxa_ first appeared in SCOPe 2.01
  
• d3lnxa_ appears in SCOPe 2.04
  
• d3lnxa_ appears in SCOPe 2.06
  
• d3lnxa_ appears in the current release, SCOPe 2.08