Lineage for d3lmed_ (3lme D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032070Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1032250Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 1032251Protein automated matches [190935] (4 species)
    not a true protein
  7. 1032265Species Rhodopseudomonas palustris [TaxId:1076] [189252] (1 PDB entry)
  8. 1032269Domain d3lmed_: 3lme D: [180384]
    automated match to d2cwja1
    complexed with so4

Details for d3lmed_

PDB Entry: 3lme (more details), 2.74 Å

PDB Description: structure of probable translation initiation inhibitor from (rpa2473) from rhodopseudomonas palustris
PDB Compounds: (D:) Possible translation initiation inhibitor

SCOPe Domain Sequences for d3lmed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lmed_ d.79.1.0 (D:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
slkiiaptdktitpsgtwsigaragdfvfiggmhgtdrvtgkmvdgdearirrmfdnmla
aaeaagatkadavrltvfvtdvakyrpvvnkvqkdiwgdgpypprtvlqvpaldqgdiae
idgtfyapa

SCOPe Domain Coordinates for d3lmed_:

Click to download the PDB-style file with coordinates for d3lmed_.
(The format of our PDB-style files is described here.)

Timeline for d3lmed_: