SCOPe 2.04: Domain d3lmbb_: 3lmb B:

Lineage for d3lmbb_ (3lmb B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (26 species)
   not a true protein

7. Species Chlorobaculum tepidum [TaxId:194439] [189276] (1 PDB entry)

8. Domain d3lmbb_: 3lmb B: [180380]
   automated match to d1t82a_

Details for d3lmbb_

PDB Entry: 3lmb, 2.1 Å

PDB Description: The crystal structure of the protein OLEI01261 with unknown function from Chlorobaculum tepidum TLS

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3lmbb_:

Sequence; same for both SEQRES and ATOM records:

>d3lmbb_ d.38.1.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 194439]}
nasltpdqvskklkqffsdhlpisqfmgleiesydgdtliltaplepnindkqtafggsl
ynaavmacwgmvylktqeeniacnqvvtegnmkyiapvygriraichapdeeelanffdh
ferkgkarisleaaiyndacvmkiepetkpsvkfngqyailkn

Timeline for d3lmbb_:

• d3lmbb_ first appeared in SCOPe 2.01
  
• d3lmbb_ appears in SCOPe 2.03
  
• d3lmbb_ appears in SCOPe 2.05
  
• d3lmbb_ appears in the current release, SCOPe 2.08