Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (26 species) not a true protein |
Species Chlorobaculum tepidum [TaxId:194439] [189276] (1 PDB entry) |
Domain d3lmbb_: 3lmb B: [180380] automated match to d1t82a_ |
PDB Entry: 3lmb (more details), 2.1 Å
SCOPe Domain Sequences for d3lmbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lmbb_ d.38.1.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 194439]} nasltpdqvskklkqffsdhlpisqfmgleiesydgdtliltaplepnindkqtafggsl ynaavmacwgmvylktqeeniacnqvvtegnmkyiapvygriraichapdeeelanffdh ferkgkarisleaaiyndacvmkiepetkpsvkfngqyailkn
Timeline for d3lmbb_: