SCOPe 2.04: Domain d3lc5b_: 3lc5 B:

Lineage for d3lc5b_ (3lc5 B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57199] (6 PDB entries)

8. Domain d3lc5b_: 3lc5 B: [180176]
   Other proteins in same PDB: d3lc5a_
   automated match to d1rfnb_
   complexed with ca, izx

Details for d3lc5b_

PDB Entry: 3lc5, 2.62 Å

PDB Description: Selective Benzothiophine Inhibitors of Factor IXa

PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d3lc5b_:

Sequence; same for both SEQRES and ATOM records:

>d3lc5b_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq

Timeline for d3lc5b_:

• d3lc5b_ first appeared in SCOPe 2.01
  
• d3lc5b_ appears in SCOPe 2.03
  
• d3lc5b_ appears in SCOPe 2.05
  
• d3lc5b_ appears in the current release, SCOPe 2.08