Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins) no insertion subdomains |
Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species) |
Species Escherichia coli [TaxId:562] [159535] (6 PDB entries) Uniprot P63228 4-185 |
Domain d3l8ea_: 3l8e A: [180080] automated match to d2gmwa1 complexed with acy, zn |
PDB Entry: 3l8e (more details), 1.64 Å
SCOPe Domain Sequences for d3l8ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l8ea_ c.108.1.19 (A:) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} ksvpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargk fteaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsard ylhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqa ikkqq
Timeline for d3l8ea_: