Lineage for d3l8ea_ (3l8e A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011204Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
    no insertion subdomains
  6. 1011205Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species)
  7. 1011206Species Escherichia coli [TaxId:562] [159535] (6 PDB entries)
    Uniprot P63228 4-185
  8. 1011209Domain d3l8ea_: 3l8e A: [180080]
    automated match to d2gmwa1
    complexed with acy, zn

Details for d3l8ea_

PDB Entry: 3l8e (more details), 1.64 Å

PDB Description: crystal structure of apo form of d,d-heptose 1.7-bisphosphate phosphatase from e. coli
PDB Compounds: (A:) D,D-heptose 1,7-bisphosphate phosphatase

SCOPe Domain Sequences for d3l8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l8ea_ c.108.1.19 (A:) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}
ksvpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargk
fteaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsard
ylhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqa
ikkqq

SCOPe Domain Coordinates for d3l8ea_:

Click to download the PDB-style file with coordinates for d3l8ea_.
(The format of our PDB-style files is described here.)

Timeline for d3l8ea_: