Lineage for d3l70h_ (3l70 H:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699300Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1699301Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 1699302Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 1699332Protein automated matches [190042] (3 species)
    not a true protein
  7. 1699333Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries)
  8. 1699340Domain d3l70h_: 3l70 H: [180011]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70g_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70s_, d3l70t_, d3l70w_
    automated match to d1bcch_
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70h_

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (H:) Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii

SCOPe Domain Sequences for d3l70h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70h_ f.28.1.1 (H:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
eeeelvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhc
vahklfnklk

SCOPe Domain Coordinates for d3l70h_:

Click to download the PDB-style file with coordinates for d3l70h_.
(The format of our PDB-style files is described here.)

Timeline for d3l70h_: