Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) automatically mapped to Pfam PF02939 |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
Protein automated matches [191133] (1 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries) |
Domain d3l70g_: 3l70 G: [180010] Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70s_, d3l70u_, d3l70w_ automated match to d1be3g_ complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw gtqeferlkrknpadyendq
Timeline for d3l70g_: