![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) |
![]() | Protein automated matches [190139] (25 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [186957] (8 PDB entries) |
![]() | Domain d3l30a_: 3l30 A: [179891] automated match to d1hn4a_ complexed with ca, cl, dbw |
PDB Entry: 3l30 (more details), 2.4 Å
SCOPe Domain Sequences for d3l30a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l30a_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt kkyc
Timeline for d3l30a_: