Lineage for d7icna1 (7icn A:9-91)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1090716Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1090717Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1090718Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 1090719Species Human (Homo sapiens) [TaxId:9606] [47805] (107 PDB entries)
    Uniprot P06746
  8. 1090745Domain d7icna1: 7icn A:9-91 [17988]
    Other proteins in same PDB: d7icna3, d7icna4
    protein/DNA complex; complexed with na

Details for d7icna1

PDB Entry: 7icn (more details), 2.8 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of nicl2
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d7icna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7icna1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOPe Domain Coordinates for d7icna1:

Click to download the PDB-style file with coordinates for d7icna1.
(The format of our PDB-style files is described here.)

Timeline for d7icna1: