Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (11 species) |
Species Bacillus cereus [TaxId:1396] [56284] (14 PDB entries) Uniprot P04190 31-257 |
Domain d3knsc_: 3kns C: [179477] automated match to d1bc2a_ complexed with acy, gol, so4, zn; mutant |
PDB Entry: 3kns (more details), 1.58 Å
SCOPe Domain Sequences for d3knsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3knsc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} tisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltkeliemvekk fqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtnlk fgnmkvetfypgkghtednivvwlpqynilvggdlvkstsakdlgnvadayvnewstsie nvlkryrninavvpghgevgdkglllhtldllk
Timeline for d3knsc_: