Lineage for d3knsc_ (3kns C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224492Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1224493Protein Zn metallo-beta-lactamase [56283] (11 species)
  7. 1224505Species Bacillus cereus [TaxId:1396] [56284] (14 PDB entries)
    Uniprot P04190 31-257
  8. 1224509Domain d3knsc_: 3kns C: [179477]
    automated match to d1bc2a_
    complexed with acy, gol, so4, zn; mutant

Details for d3knsc_

PDB Entry: 3kns (more details), 1.58 Å

PDB Description: bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii)
PDB Compounds: (C:) Beta-lactamase 2

SCOPe Domain Sequences for d3knsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3knsc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
tisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltkeliemvekk
fqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtnlk
fgnmkvetfypgkghtednivvwlpqynilvggdlvkstsakdlgnvadayvnewstsie
nvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d3knsc_:

Click to download the PDB-style file with coordinates for d3knsc_.
(The format of our PDB-style files is described here.)

Timeline for d3knsc_: