Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein) |
Protein DNA helicase RuvA subunit, middle domain [47783] (3 species) tetramer; binds Holliday junction |
Species Escherichia coli [TaxId:562] [47784] (5 PDB entries) |
Domain d1hjpa2: 1hjp A:65-140 [17947] Other proteins in same PDB: d1hjpa1, d1hjpa3 |
PDB Entry: 1hjp (more details), 2.5 Å
SCOPe Domain Sequences for d1hjpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjpa2 a.60.2.1 (A:65-140) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl ivemkdrfkglhgdlf
Timeline for d1hjpa2: