Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
Protein automated matches [190031] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188353] (21 PDB entries) |
Domain d3kkae_: 3kka E: [179400] automated match to d1f0ma_ complexed with cl |
PDB Entry: 3kka (more details), 2.4 Å
SCOPe Domain Sequences for d3kkae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkae_ a.60.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysl lglkdq
Timeline for d3kkae_:
View in 3D Domains from other chains: (mouse over for more information) d3kkaa_, d3kkab_, d3kkac_, d3kkad_ |