SCOPe 2.08: Domain d3kb2a1: 3kb2 A:2-165

Lineage for d3kb2a1 (3kb2 A:2-165)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189093] (1 PDB entry)

8. Domain d3kb2a1: 3kb2 A:2-165 [179229]
   Other proteins in same PDB: d3kb2a2, d3kb2b2
   automated match to d2axpa1
   complexed with g3d, mg

Details for d3kb2a1

PDB Entry: 3kb2, 2.2 Å

PDB Description: crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256

PDB Compounds: (A:) SPBc2 prophage-derived uncharacterized protein yorR

SCOPe Domain Sequences for d3kb2a1:

Sequence; same for both SEQRES and ATOM records:

>d3kb2a1 c.37.1.1 (A:2-165) automated matches {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve

Timeline for d3kb2a1:

• d3kb2a1 first appeared in SCOPe 2.01, called d3kb2a_
  
• d3kb2a1 appears in SCOPe 2.07