Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (15 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189093] (1 PDB entry) |
Domain d3kb2a1: 3kb2 A:2-165 [179229] Other proteins in same PDB: d3kb2a2, d3kb2b2 automated match to d2axpa1 complexed with g3d, mg |
PDB Entry: 3kb2 (more details), 2.2 Å
SCOPe Domain Sequences for d3kb2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kb2a1 c.37.1.1 (A:2-165) automated matches {Bacillus subtilis [TaxId: 1423]} tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve
Timeline for d3kb2a1: