Lineage for d1ffvd1 (1ffv D:82-157)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493241Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1493242Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1493243Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 1493265Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 1493266Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (2 PDB entries)
  8. 1493268Domain d1ffvd1: 1ffv D:82-157 [17916]
    Other proteins in same PDB: d1ffva2, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd2, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2
    complexed with fad, fes, pcd

Details for d1ffvd1

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
PDB Compounds: (D:) cuts, iron-sulfur protein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvd1 a.56.1.1 (D:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
nkgvlhavqegfykehglqcgfctpgmlmrayrflqenpnpteaeirmgmtgnlcrctgy
qnivkavqyaarklqe

SCOPe Domain Coordinates for d1ffvd1:

Click to download the PDB-style file with coordinates for d1ffvd1.
(The format of our PDB-style files is described here.)

Timeline for d1ffvd1: