Lineage for d1ffvf2 (1ffv F:1-177)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675806Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1675813Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 1675814Species Hydrogenophaga pseudoflava [TaxId:47421] [56190] (2 PDB entries)
  8. 1675816Domain d1ffvf2: 1ffv F:1-177 [41755]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvd1, d1ffvd2, d1ffve1, d1ffve2, d1ffvf1
    complexed with fad, fes, pcd

Details for d1ffvf2

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
PDB Compounds: (F:) cutm, flavoprotein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffvf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvf2 d.145.1.3 (F:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaq

SCOPe Domain Coordinates for d1ffvf2:

Click to download the PDB-style file with coordinates for d1ffvf2.
(The format of our PDB-style files is described here.)

Timeline for d1ffvf2: