SCOPe 2.01: Domain d3k7ob_: 3k7o B:

Lineage for d3k7ob_ (3k7o B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (1 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [189510] (4 PDB entries)

8. Domain d3k7ob_: 3k7o B: [179150]
   automated match to d1nn4b_

Details for d3k7ob_

PDB Entry: 3k7o, 2 Å

PDB Description: Structure of type B ribose 5-phosphate isomerase from Trypanosoma cruzi

PDB Compounds: (B:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3k7ob_:

Sequence; same for both SEQRES and ATOM records:

>d3k7ob_ c.121.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
rrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvarkev
efgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevire
iiitflqtpfsgeerhvrriekiraieash

Timeline for d3k7ob_:

• d3k7ob_ is new in SCOPe 2.01-stable
  
• d3k7ob_ appears in SCOPe 2.02
  
• d3k7ob_ appears in the current release, SCOPe 2.08