Lineage for d3k38f_ (3k38 F:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959827Protein automated matches [190279] (4 species)
    not a true protein
  7. 959864Species Influenza b virus [TaxId:343983] [189447] (5 PDB entries)
  8. 959874Domain d3k38f_: 3k38 F: [178993]
    automated match to d1a4ga_
    complexed with ca, nag, so4, yt3; mutant

Details for d3k38f_

PDB Entry: 3k38 (more details), 2.19 Å

PDB Description: crystal structure of b/perth neuraminidase d197e mutant
PDB Compounds: (F:) Neuraminidase

SCOPe Domain Sequences for d3k38f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k38f_ b.68.1.1 (F:) automated matches {Influenza b virus [TaxId: 343983]}
pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
whsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d3k38f_:

Click to download the PDB-style file with coordinates for d3k38f_.
(The format of our PDB-style files is described here.)

Timeline for d3k38f_: