Lineage for d3jwfb_ (3jwf B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004553Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1004554Protein automated matches [190777] (8 species)
    not a true protein
  7. 1004555Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (10 PDB entries)
  8. 1004574Domain d3jwfb_: 3jwf B: [178872]
    automated match to d1draa_
    complexed with 5wa, nap

Details for d3jwfb_

PDB Entry: 3jwf (more details), 2.57 Å

PDB Description: crystal structure of bacillus anthracis (y102f) dihydrofolate reductase complexed with nadph and (r)-2,4-diamino-5-(3-hydroxy-3-(3, 4,5-trimethoxyphenyl)prop-1-ynyl)-6-methylpyrimidine (ucp113a)
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3jwfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwfb_ c.71.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
hhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpg
rrniivtrnegyhvegcevahsveevfelckneeeififggaqifdlflpyvdklyitki
hhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d3jwfb_:

Click to download the PDB-style file with coordinates for d3jwfb_.
(The format of our PDB-style files is described here.)

Timeline for d3jwfb_: