Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (15 species) not a true protein |
Species Bay scallop (Argopecten irradians) [TaxId:31199] [189156] (2 PDB entries) |
Domain d3jvtb_: 3jvt B: [178848] Other proteins in same PDB: d3jvtc_ automated match to d1kk7y_ complexed with ca, mg |
PDB Entry: 3jvt (more details), 2.1 Å
SCOPe Domain Sequences for d3jvtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jvtb_ a.39.1.5 (B:) automated matches {Bay scallop (Argopecten irradians) [TaxId: 31199]} adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf nkdemrmtfkeapveggkfdyvkftamikgsgeeea
Timeline for d3jvtb_: