PDB entry 3jvt
View 3jvt on RCSB PDB site
Description: Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete Light Chains
Class: contractile protein
Keywords: Regulated myosins, smooth and molluscan muscle, X-ray crystallographic structure, scallop regulatory domain/lever arm, on-state, calcium-binding protein, Actin-binding, ATP-binding, Calmodulin-binding, Coiled coil, Cytoplasm, Motor protein, Muscle protein, Myosin, Nucleotide-binding, Thick filament, Calcium, CONTRACTILE PROTEIN
Deposited on
2009-09-17, released
2009-12-01
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-12-01, with a file datestamp of
2009-11-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Myosin heavy chain, striated adductor muscle
Species: Argopecten irradians [TaxId:31199]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: myosin regulatory light chain, striated adductor muscle
Species: Argopecten irradians [TaxId:31199]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3jvtb_ - Chain 'C':
Compound: myosin essential light chain, striated adductor muscle
Species: Argopecten irradians [TaxId:31199]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3jvtc_ - Heterogens: MG, CA, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3jvtB (B:)
adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
nkdemrmtfkeapveggkfdyvkftamikgsgeeea
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3jvtC (C:)
pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpypdk