Lineage for d3ixha_ (3ixh A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3012734Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 3012776Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)
  8. 3012995Domain d3ixha_: 3ixh A: [178671]
    automated match to d1c3ba_
    complexed with cef; mutant

Details for d3ixha_

PDB Entry: 3ixh (more details), 2.3 Å

PDB Description: x-ray crystal structure of the extended-spectrum ampc y221g mutant beta-lactamase in complex with cefotaxime at 2.3 angstrom resolution
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3ixha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ixha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaggvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d3ixha_:

Click to download the PDB-style file with coordinates for d3ixha_.
(The format of our PDB-style files is described here.)

Timeline for d3ixha_: