SCOPe 2.01: Domain d3iuta_: 3iut A:

Lineage for d3iuta_ (3iut A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (19 PDB entries)

8. Domain d3iuta_: 3iut A: [178621]
   automated match to d1ewla_
   complexed with edo, kb2

Details for d3iuta_

PDB Entry: 3iut, 1.2 Å

PDB Description: the crystal structure of cruzain in complex with a tetrafluorophenoxymethyl ketone inhibitor

PDB Compounds: (A:) Cruzipain

SCOPe Domain Sequences for d3iuta_:

Sequence; same for both SEQRES and ATOM records:

>d3iuta_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlaeqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndgaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d3iuta_:

• d3iuta_ is new in SCOPe 2.01-stable
  
• d3iuta_ appears in SCOPe 2.02
  
• d3iuta_ appears in the current release, SCOPe 2.08