SCOPe 2.03: Domain d3ia5b_: 3ia5 B:

Lineage for d3ia5b_ (3ia5 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (16 species)
   not a true protein

7. Species Moritella profunda [TaxId:111291] [189013] (3 PDB entries)

8. Domain d3ia5b_: 3ia5 B: [178201]
   automated match to d1dhja_
   complexed with po4

Details for d3ia5b_

PDB Entry: 3ia5, 2.1 Å

PDB Description: Moritella profunda dihydrofolate reductase (DHFR)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3ia5b_:

Sequence, based on SEQRES records:

>d3ia5b_ c.71.1.0 (B:) automated matches {Moritella profunda [TaxId: 111291]}
mivsmiaalannrvigldnkmpwhlpaelqlfkratlgkpivmgrntfesigrplpgrln
ivlsrqtdyqpegvtvvatledavvaagdveelmiiggatiynqclaaadrlylthielt
tegdtwfpdyeqynwqeiehesyaaddknphnyrfsllervk

Sequence, based on observed residues (ATOM records):

>d3ia5b_ c.71.1.0 (B:) automated matches {Moritella profunda [TaxId: 111291]}
mivsmiaalannrvigldnkmpwhlpaelqlfkratlgkpivmgrntfesigrplpgrln
ivlsrqdyqpegvtvvatledavvaagdveelmiiggatiynqclaaadrlylthieltt
egdtwfpdyeqynwqeiehesyaaddknphnyrfsllervk

Timeline for d3ia5b_:

• d3ia5b_ first appeared in SCOPe 2.01
  
• d3ia5b_ appears in SCOPe 2.02
  
• d3ia5b_ appears in SCOPe 2.04
  
• d3ia5b_ appears in the current release, SCOPe 2.08