Lineage for d3i7ya_ (3i7y A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1192691Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1192692Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1192693Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1193024Protein automated matches [190061] (4 species)
    not a true protein
  7. 1193025Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)
  8. 1193131Domain d3i7ya_: 3i7y A: [178141]
    automated match to d1a2wa_
    complexed with cl

Details for d3i7ya_

PDB Entry: 3i7y (more details), 2.4 Å

PDB Description: high pressure structure of i106a variant of rnase a (0.48 gpa)
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d3i7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i7ya_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhaivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3i7ya_:

Click to download the PDB-style file with coordinates for d3i7ya_.
(The format of our PDB-style files is described here.)

Timeline for d3i7ya_: