Lineage for d3i6va_ (3i6v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916133Species Silicibacter pomeroyi [TaxId:89184] [189007] (1 PDB entry)
  8. 2916134Domain d3i6va_: 3i6v A: [178120]
    automated match to d1lafe_
    complexed with gol, lys, na

Details for d3i6va_

PDB Entry: 3i6v (more details), 2 Å

PDB Description: crystal structure of a periplasmic his/glu/gln/arg/opine family- binding protein from silicibacter pomeroyi in complex with lysine
PDB Compounds: (A:) periplasmic His/Glu/Gln/Arg/opine family-binding protein

SCOPe Domain Sequences for d3i6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6va_ c.94.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
tvrmgtegayppynfindagevdgferelgdelckragltcewvkndwdsiipnlvsgny
dtiiagmsitderdevidftqnyipptassyvatsdgadlsgivaaqtatiqagyiaesg
atlvefatpeetiaavrngeadavfadrdylvpivaesggelmfvgddvplgggvgmglr
esdgelrgkfdaaitsmkedgtlntmikkwfgedaavy

SCOPe Domain Coordinates for d3i6va_:

Click to download the PDB-style file with coordinates for d3i6va_.
(The format of our PDB-style files is described here.)

Timeline for d3i6va_: