Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [190915] (4 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189151] (1 PDB entry) |
Domain d3i2zb_: 3i2z B: [178035] automated match to d1mjca_ |
PDB Entry: 3i2z (more details), 1.1 Å
SCOPe Domain Sequences for d3i2zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i2zb_ b.40.4.5 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} kikgnvkwfneskgfgfitpedgskdvfvhfsaiqtngfktlaegqrvefeitngakgps aanvtal
Timeline for d3i2zb_: