SCOPe 2.01: Domain d3i2zb_: 3i2z B:

Lineage for d3i2zb_ (3i2z B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein automated matches [190915] (4 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189151] (1 PDB entry)

8. Domain d3i2zb_: 3i2z B: [178035]
   automated match to d1mjca_

Details for d3i2zb_

PDB Entry: 3i2z, 1.1 Å

PDB Description: Structure of cold shock protein E from Salmonella typhimurium

PDB Compounds: (B:) RNA chaperone, negative regulator of cspA transcription

SCOPe Domain Sequences for d3i2zb_:

Sequence; same for both SEQRES and ATOM records:

>d3i2zb_ b.40.4.5 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
kikgnvkwfneskgfgfitpedgskdvfvhfsaiqtngfktlaegqrvefeitngakgps
aanvtal

Timeline for d3i2zb_:

• d3i2zb_ is new in SCOPe 2.01-stable
  
• d3i2zb_ appears in SCOPe 2.02
  
• d3i2zb_ appears in the current release, SCOPe 2.08