Lineage for d3hqdb_ (3hqd B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 988762Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 988890Protein automated matches [190129] (3 species)
    not a true protein
  7. 988891Species Human (Homo sapiens) [TaxId:9606] [187145] (21 PDB entries)
  8. 988916Domain d3hqdb_: 3hqd B: [177778]
    automated match to d1q0bb_
    complexed with anp, mg, po4

Details for d3hqdb_

PDB Entry: 3hqd (more details), 2.19 Å

PDB Description: Human kinesin Eg5 motor domain in complex with AMPPNP and Mg2+
PDB Compounds: (B:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d3hqdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqdb_ c.37.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
kigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyreskl
trilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevn

SCOPe Domain Coordinates for d3hqdb_:

Click to download the PDB-style file with coordinates for d3hqdb_.
(The format of our PDB-style files is described here.)

Timeline for d3hqdb_: