SCOPe 2.02: Domain d3hofa_: 3hof A:

Lineage for d3hofa_ (3hof A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (31 PDB entries)

8. Domain d3hofa_: 3hof A: [177731]
   automated match to d1gcza_
   complexed with dhc

Details for d3hofa_

PDB Entry: 3hof, 1.9 Å

PDB Description: Structure of macrophage migration inhibitory factor (MIF) with caffeic acid at 1.9A resolution

PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d3hofa_:

Sequence; same for both SEQRES and ATOM records:

>d3hofa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfalehh

Timeline for d3hofa_:

• d3hofa_ first appeared in SCOPe 2.01
  
• d3hofa_ appears in SCOPe 2.03
  
• d3hofa_ appears in the current release, SCOPe 2.08, called d3hofa1