Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189358] (1 PDB entry) |
Domain d3hmca1: 3hmc A:4-190 [177695] Other proteins in same PDB: d3hmca2 automated match to d1jfxa_ complexed with mes |
PDB Entry: 3hmc (more details), 1.44 Å
SCOPe Domain Sequences for d3hmca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hmca1 c.1.8.0 (A:4-190) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mghiidiskwngdinwsiakqhidfiiarvqdgsnyvdplykgyvqamkqhgipfgnyaf crfvsiadakkeaqdfwnrgdksatvwvadvevktmndmragtqafidelyrlgakkvgl yvghhmytpfgmanvksdfvwipryggnkpaypcdiwqytetgnvpgigkcdlnslignk slswfte
Timeline for d3hmca1: