SCOPe 2.08: Domain d3hmca1: 3hmc A:4-190

Lineage for d3hmca1 (3hmc A:4-190)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189358] (1 PDB entry)

8. Domain d3hmca1: 3hmc A:4-190 [177695]
   Other proteins in same PDB: d3hmca2
   automated match to d1jfxa_
   complexed with mes

Details for d3hmca1

PDB Entry: 3hmc, 1.44 Å

PDB Description: Endolysin from Bacillus anthracis

PDB Compounds: (A:) Putative prophage LambdaBa04, glycosyl hydrolase, family 25

SCOPe Domain Sequences for d3hmca1:

Sequence; same for both SEQRES and ATOM records:

>d3hmca1 c.1.8.0 (A:4-190) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mghiidiskwngdinwsiakqhidfiiarvqdgsnyvdplykgyvqamkqhgipfgnyaf
crfvsiadakkeaqdfwnrgdksatvwvadvevktmndmragtqafidelyrlgakkvgl
yvghhmytpfgmanvksdfvwipryggnkpaypcdiwqytetgnvpgigkcdlnslignk
slswfte

Timeline for d3hmca1:

• d3hmca1 first appeared in SCOPe 2.01, called d3hmca_
  
• d3hmca1 appears in SCOPe 2.07