Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein automated matches [190260] (25 species) not a true protein |
Species Hepatitis C virus subtype 1b [TaxId:31647] [187148] (6 PDB entries) |
Domain d3hhkb_: 3hhk B: [177579] automated match to d1nb4a_ protein/RNA complex; complexed with 77z |
PDB Entry: 3hhk (more details), 1.7 Å
SCOPe Domain Sequences for d3hhkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhkb_ e.8.1.4 (B:) automated matches {Hepatitis C virus subtype 1b [TaxId: 31647]} smsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvl ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih svwkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs tlpqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiy qccdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkas aacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeydl elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw armilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspg einrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpip aasqldlsgwfvagysggdiyhs
Timeline for d3hhkb_: