SCOPe 2.01: Domain d3hh7a_: 3hh7 A:

Lineage for d3hh7a_ (3hh7 A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.0: automated matches [191613] (1 protein)
   not a true family

6. Protein automated matches [191119] (1 species)
   not a true protein

7. Species King cobra (Ophiophagus hannah) [TaxId:8665] [189185] (1 PDB entry)

8. Domain d3hh7a_: 3hh7 A: [177571]
   automated match to d1ntxa_

Details for d3hh7a_

PDB Entry: 3hh7, 1.55 Å

PDB Description: structural and functional characterization of a novel homodimeric three-finger neurotoxin from the venom of ophiophagus hannah (king cobra)

PDB Compounds: (A:) Muscarinic toxin-like protein 3 homolog

SCOPe Domain Sequences for d3hh7a_:

Sequence; same for both SEQRES and ATOM records:

>d3hh7a_ g.7.1.0 (A:) automated matches {King cobra (Ophiophagus hannah) [TaxId: 8665]}
tkcynhqsttpetteicpdsgyfcyksswidgregriergctftcpeltpngkyvyccrr
dkcnq

Timeline for d3hh7a_:

• d3hh7a_ is new in SCOPe 2.01-stable
  
• d3hh7a_ appears in SCOPe 2.02
  
• d3hh7a_ appears in the current release, SCOPe 2.08