SCOPe 2.01: Domain d3hgmb_: 3hgm B:

Lineage for d3hgmb_ (3hgm B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (8 species)
   not a true protein

7. Species Halomonas elongata [TaxId:2746] [189250] (1 PDB entry)

8. Domain d3hgmb_: 3hgm B: [177548]
   automated match to d1mjha_
   complexed with atp, mg

Details for d3hgmb_

PDB Entry: 3hgm, 1.9 Å

PDB Description: Universal Stress Protein TeaD from the TRAP transporter TeaABC of Halomonas elongata

PDB Compounds: (B:) Universal Stress Protein TeaD

SCOPe Domain Sequences for d3hgmb_:

Sequence; same for both SEQRES and ATOM records:

>d3hgmb_ c.26.2.0 (B:) automated matches {Halomonas elongata [TaxId: 2746]}
mfnrimvpvdgskgavkalekgvglqqltgaelyilcvfkhhslleaslsmarpeqldip
ddalkdyateiavqaktratelgvpadkvrafvkggrpsrtivrfarkrecdlvvigaqg
tngdkslllgsvaqrvagsahcpvlvv

Timeline for d3hgmb_:

• d3hgmb_ is new in SCOPe 2.01-stable
  
• d3hgmb_ appears in SCOPe 2.02
  
• d3hgmb_ appears in the current release, SCOPe 2.08