Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species) similar to class phi enzymes |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries) |
Domain d1g6wc1: 1g6w C:201-354 [17753] Other proteins in same PDB: d1g6wa2, d1g6wb2, d1g6wc2, d1g6wd2 |
PDB Entry: 1g6w (more details), 2.5 Å
SCOPe Domain Sequences for d1g6wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6wc1 a.45.1.1 (C:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv driginikiefpevykwtkhmmrrpavikalrge
Timeline for d1g6wc1: