Lineage for d3hema_ (3hem A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501177Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 2501213Protein automated matches [191052] (2 species)
    not a true protein
  7. 2501214Species Mycobacterium tuberculosis [TaxId:1773] [188911] (1 PDB entry)
  8. 2501215Domain d3hema_: 3hem A: [177452]
    automated match to d1kpia_
    complexed with co3, d22

Details for d3hema_

PDB Entry: 3hem (more details), 2.39 Å

PDB Description: structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine
PDB Compounds: (A:) Cyclopropane-fatty-acyl-phospholipid synthase 2

SCOPe Domain Sequences for d3hema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hema_ c.66.1.18 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldklnle
pgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgw
eefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkee
aqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptl
nawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk

SCOPe Domain Coordinates for d3hema_:

Click to download the PDB-style file with coordinates for d3hema_.
(The format of our PDB-style files is described here.)

Timeline for d3hema_: