Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins) |
Protein automated matches [191052] (1 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [188911] (1 PDB entry) |
Domain d3hema_: 3hem A: [177452] automated match to d1kpia_ complexed with co3, d22 |
PDB Entry: 3hem (more details), 2.39 Å
SCOPe Domain Sequences for d3hema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hema_ c.66.1.18 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldklnle pgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgw eefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkee aqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptl nawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk
Timeline for d3hema_: